. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. VHRDLAARNCM VHRDLAARNCM Vlb ,ssj :KTi VII TK domain VII VIII .KIGDFGFTRDIYESDYYRKIi .KIGDFGFTRDIYESDYYRXJ J< IGDFGFT RDI YE S D YYRK1. INR_SR1 INR_SR2 INR SR3 RDCIDCTAYSFEIRiFYFEVHDMLEYIDIWILLLVFTSLLARSTRSIKPHRAYASSYHHNDV : 616 DHTSLKLRGRTENQGHNVSTWLWTNANDSYYPLPSHV : 614 Figure 2. Alignment of the deduced aa sequences of the InsR-like sequences from Sycon raphamis type 1 (INR_SR1). type 2 (INR_SR2), and type 3 (INR_SR3). The four segments of the sequences are the extracellular domains (EC domain); the transmembrane segmen
. The Biological bulletin. Biology; Zoology; Biology; Marine Biology. VHRDLAARNCM VHRDLAARNCM Vlb ,ssj :KTi VII TK domain VII VIII .KIGDFGFTRDIYESDYYRKIi .KIGDFGFTRDIYESDYYRXJ J< IGDFGFT RDI YE S D YYRK1. INR_SR1 INR_SR2 INR SR3 RDCIDCTAYSFEIRiFYFEVHDMLEYIDIWILLLVFTSLLARSTRSIKPHRAYASSYHHNDV : 616 DHTSLKLRGRTENQGHNVSTWLWTNANDSYYPLPSHV : 614 Figure 2. Alignment of the deduced aa sequences of the InsR-like sequences from Sycon raphamis type 1 (INR_SR1). type 2 (INR_SR2), and type 3 (INR_SR3). The four segments of the sequences are the extracellular domains (EC domain); the transmembrane segments (TM); and the two intracellular domains, the juxtamem- brane domain (JM domain) and the catalytic domain (TK domain). The TK domain is subdivided into the 12 subdomains (above the sequence) with the characteristic TK-specific active-site signature (Tyr-signature [—• -]) and RTK class II signature (<—class II—) (below the sequence); in addition, the putative ATP- hinding-site (ATP) is marked. In the extracellular domain, the conserved Cys residues (arrowhead) of the two EGF-like domains (EGF-like) are indicated. Identical amino acid residues are shown in white-on-black type, and residues conserved in at least two sequences are shaded. other meuizoan phyla to arise. Second, the phylogenetic analyses ,-'n that, based on the autapomorphic character for Metazoa, llie RTKs, sponges as a taxon are monophy- letic; the Hexactinellida have been calculated to be the oldest class, followed by the Demospongia and finally by the Calcarea. Third, EGF-like domains are already present. Please note that these images are extracted from scanned page images that may have been digitally enhanced for readability - coloration and appearance of these illustrations may not perfectly resemble the original Marine Biological Laboratory (Woods Hole, Mass. ); Marine Biological Laboratory (Woods Hole, Mass. ). Annual report 1907/08-1952; Lillie, Frank Rattray, 1870-1947; Moore, Carl
Size: 3477px × 719px
Photo credit: © Library Book Collection / Alamy / Afripics
License: Licensed
Model Released: No
Keywords: ., bookauthorlilliefrankrat, booksubjectbiology, booksubjectzoology
